PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0396s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 346aa    MW: 36803.7 Da    PI: 7.9617
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0396s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022236.1e-691162653154
                  DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsst 89 
                              g++sCqdCGnqakkdC h+RCRtCCksrgf+C+thvkstWvpa+krrerq+ql+a +++++++ +   ++ kr+ ++ ++s+l++t
  SapurV1A.0396s0190.1.p 116 GGSISCQDCGNQAKKDCLHMRCRTCCKSRGFECQTHVKSTWVPASKRRERQHQLTAFQQQQQQQLQIRGENPKRQRENPSSSSLACT 202
                             5789****************************************************9999988885555555555555788888999 PP

                  DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                             +l+++   + le  ++P+evss+a+frcvrv+ +d++ee laYqtav+igGhvfkGiLyd+G+e+
  SapurV1A.0396s0190.1.p 203 RLANNM--SGLELGNFPAEVSSPALFRCVRVGDIDESEEMLAYQTAVNIGGHVFKGILYDHGPES 265
                             887775..5689999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.6E-66118264IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.0E-28120162IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.9E-23216263IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAGLFSLGRG RSSSSGGNNQ EQQNNNPTAE IPQENWFPYR SEDISYKGFE PWQQQQHQEL  60
IHQRHQNPQQ DLYSSAVGLG VGPSRASINI SEESSSRSAA AAAAFMMMRP VGSGGGGSIS  120
CQDCGNQAKK DCLHMRCRTC CKSRGFECQT HVKSTWVPAS KRRERQHQLT AFQQQQQQQL  180
QIRGENPKRQ RENPSSSSLA CTRLANNMSG LELGNFPAEV SSPALFRCVR VGDIDESEEM  240
LAYQTAVNIG GHVFKGILYD HGPESNYMAP GETSSGGGGG GGGGGRSLNL ITAGTAATSA  300
SVSATGGGGV TVASTTAAFL DPSSLYPAPL NTFMAGTQFF PNPRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754417e-35HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755147e-35HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
GenBankKC3319107e-35KC331910.1 Solanum lycopersicum expression of terpenoids 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028610.11e-175PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD401e-102SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLB9MXK11e-161B9MXK1_POPTR; SHORT INTERNODES family protein
STRINGPOPTR_0005s12020.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.13e-76Lateral root primordium (LRP) protein-related